| Sequence 1: | NP_001138149.1 | Gene: | Ugalt / 31255 | FlyBaseID: | FBgn0024994 | Length: | 368 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_418343.1 | Gene: | rhaT / 948398 | ECOCYCID: | EG11313 | Length: | 344 | Species: | Escherichia coli |
| Alignment Length: | 198 | Identity: | 40/198 - (20%) |
|---|---|---|---|
| Similarity: | 70/198 - (35%) | Gaps: | 64/198 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 208 AALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDL 272
Fly 273 F-------VWYLVLLQAGGGLIVAVVVKYADNILK-GFATSLAIIISCVASIYI---FDF----- 321
Fly 322 --NLTL-----------------------------QFSFGAGLVIA---SIFLYGYDPARSAPKP 352
Fly 353 TMH 355 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ugalt | NP_001138149.1 | Nuc_sug_transp | 18..342 | CDD:282054 | 33/183 (18%) |
| EamA | 101..341 | CDD:304911 | 33/182 (18%) | ||
| rhaT | NP_418343.1 | RhaT | 1..343 | CDD:302813 | 40/198 (20%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0697 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||