DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and bioP

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_418271.1 Gene:bioP / 948309 ECOCYCID:EG11471 Length:299 Species:Escherichia coli


Alignment Length:250 Identity:51/250 - (20%)
Similarity:93/250 - (37%) Gaps:74/250 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LVYIVQNNLLYVSASHLDAATYQVTYQLKILT--TAMFAVVIL----RRKLLNTQWG----ALLL 161
            ||..:|..::|:.:  ..|..|....:|.:.|  |.::..:|.    :|:|   :||    |||.
E. coli    62 LVGAMQLGVMYMLS--FRAYLYLTVSELLLFTVLTPLYITLIYDIMSKRRL---RWGYAFSALLA 121

  Fly   162 LV---------------MGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALG 211
            ::               .|::||||:...     .|.|.........:...|:.|..  .|..||
E. coli   122 VIGAGIIRYDQVTDHFWTGLLLVQLSNIT-----FAIGMVGYKRLMETRPMPQHNAF--AWFYLG 179

  Fly   212 ACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWY 276
            |..::..|  :|  :|..|:        ::...::.:|:|         :|......|...|:|.
E. coli   180 AFLVAVIA--WF--LLGNAQ--------KMPQTTLQWGIL---------VFLGVVASGIGYFMWN 223

  Fly   277 LVLLQ--AG-----------GGLIVAVVVKYADNILKGFATSLAIIISCVASIYI 318
            ....|  ||           .||:|.:.:.:.......|.|...:|:   ||:::
E. coli   224 YGATQVDAGTLGIMNNMHVPAGLLVNLAIWHQQPHWPTFITGALVIL---ASLWV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 51/249 (20%)
EamA 101..341 CDD:304911 51/249 (20%)
bioPNP_418271.1 2A78 11..273 CDD:273359 50/246 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.