DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and yhbE

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_417651.1 Gene:yhbE / 947699 ECOCYCID:EG11499 Length:321 Species:Escherichia coli


Alignment Length:187 Identity:47/187 - (25%)
Similarity:71/187 - (37%) Gaps:49/187 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 NNLLYVSA-SHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIV------LVQ 170
            |.:|:.|: .:|.....||..||..:...:.:|.||:.|:.:||....|:|:.|:|      ||:
E. coli    85 NFILFSSSLQYLSPTASQVIGQLSPVGMMVASVFILKEKMRSTQVVGALMLLSGLVMFFNTSLVE 149

  Fly   171 L-AQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIY-------FEKIL 227
            : .:....|.|...|..||....|.|.|  |..:|...|:....||     :|       |....
E. coli   150 IFTKLTDYTWGVIFGVGAATVWVSYGVA--QKVLLRRLASPQILFL-----LYTLCTIALFPLAK 207

  Fly   228 KG--AEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQA 282
            .|  |::|.|.              |.|.:           |.|.:..|.|..|.:|
E. coli   208 PGVIAQLSHWQ--------------LACLI-----------FCGLNTLVGYGALAEA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 47/187 (25%)
EamA 101..341 CDD:304911 47/187 (25%)
yhbENP_417651.1 RhaT 1..304 CDD:223769 47/187 (25%)
EamA 6..143 CDD:307170 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.