DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and yedA

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_416468.1 Gene:yedA / 946461 ECOCYCID:EG11141 Length:306 Species:Escherichia coli


Alignment Length:239 Identity:56/239 - (23%)
Similarity:84/239 - (35%) Gaps:75/239 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 MFAVVILR-------RKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAA---TAASSG 195
            :.|.::||       |.|||.....||||.:|..:|.:|:.:...||.|....|..   |...| 
E. coli    51 LLAFLLLRGHKLPPLRPLLNAALIGLLLLAVGNGMVTVAEHQNVPSGIAAVVVATVPLFTLCFS- 114

  Fly   196 GAPEQNRMLGL------WAALGACFLSGFAGIYFEK--------------ILKGAEISVWMRNVQ 240
                  |:.|:      |..:..    |.|||....              ||.|: ||....:|.
E. coli   115 ------RLFGIKTRKLEWVGIAI----GLAGIIMLNSGGNLSGNPWGAILILIGS-ISWAFGSVY 168

  Fly   241 LSLLSIPFGLLTCFVN--------------DGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAV- 290
            .|.:::|.|::...:.              .|.::.......|: |.|.||.|.    |.|:|: 
E. coli   169 GSRITLPVGMMAGAIEMLAAGVVLMIASMIAGEKLTALPSLSGF-LAVGYLALF----GSIIAIN 228

  Fly   291 -VVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGL 333
             .:....|:....|||.|.:...||.:            .|.||
E. coli   229 AYMYLIRNVSPALATSYAYVNPVVAVL------------LGTGL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 56/239 (23%)
EamA 101..341 CDD:304911 56/239 (23%)
yedANP_416468.1 PRK11272 1..292 CDD:183067 56/239 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.