DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and yddG

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_415990.5 Gene:yddG / 945942 ECOCYCID:EG12713 Length:293 Species:Escherichia coli


Alignment Length:274 Identity:56/274 - (20%)
Similarity:97/274 - (35%) Gaps:106/274 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 YIVQNNLLYVS------------ASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLL 161
            |::..:||:||            |:|..|....:...|....|.:||::...:|   |.|    |
E. coli    64 YLLAGSLLFVSYEICLALSLGYAATHHQAIEVGMVNYLWPSLTILFAILFNGQK---TNW----L 121

  Fly   162 LVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACF-LSGFAGIYFEK 225
            :|.|::|                                       |.:|.|: |.|..|:::::
E. coli   122 IVPGLLL---------------------------------------ALVGVCWVLGGDNGLHYDE 147

  Fly   226 ILKGAEISVWMRNVQLSLLSIPFGLLTCFV--------NDGSRIFDQG-----FFKGYDLFVWYL 277
            |:         .|:..|.||.....:..|:        |..:|.|: |     ...|..|:|:|.
E. coli   148 II---------NNITTSPLSYFLAFIGAFIWAAYCTVTNKYARGFN-GITVFVLLTGASLWVYYF 202

  Fly   278 VLLQAGGGLIVAVVVK-----------YAD---NILKGFATSLA-------IIISCVASIYIFDF 321
            :..|........|::|           ||.   .||.|..|.:|       ::.|.:|::.:   
E. coli   203 LTPQPEMIFSTPVMIKLISAAFTLGFAYAAWNVGILHGNVTIMAVGSYFTPVLSSALAAVLL--- 264

  Fly   322 NLTLQFSFGAGLVI 335
            :..|.|||..|.::
E. coli   265 SAPLSFSFWQGALM 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 56/274 (20%)
EamA 101..341 CDD:304911 56/274 (20%)
yddGNP_415990.5 PRK11689 2..292 CDD:183277 56/274 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.