DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and CG42514

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_730171.1 Gene:CG42514 / 8674108 FlyBaseID:FBgn0260388 Length:533 Species:Drosophila melanogaster


Alignment Length:346 Identity:67/346 - (19%)
Similarity:115/346 - (33%) Gaps:118/346 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VNANTLKYISLLTLTLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDA 81
            |||.      :.|..:||.|      |:.|.|       :|:..|:.|...:|...:.:      
  Fly   167 VNAR------MTTWPVQNII------YSATLP-------SALTGADVAIFASCFAYISD------ 206

  Fly    82 QKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI 146
               :.||.:.       |::|.:..::|:....:.....|||....:..:|      ..||.|  
  Fly   207 ---ISSLQQR-------TIRVTILDVIYLSAMPMGVALGSHLFYNVFNQSY------ADMFTV-- 253

  Fly   147 LRRKLLNTQWGALLLLVMGIVLVQLA---QTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWA 208
                  |..     ||.:.|:....|   ||                      .|.|..:    .
  Fly   254 ------NAS-----LLALAIIYTLCALKWQT----------------------TPRQRSL----R 281

  Fly   209 ALGACFLSGFAGIYFEKILKGAEISVWM------RNVQLSLLSIPFGLLTCFVNDGSRIF----- 262
            .||.|   ||.|.:|:|......::|.:      |...|.:|.:...|.|...::|..::     
  Fly   282 ELGCC---GFWGDFFDKQHVKDSLAVLVKPRKGHRRSFLIILLVSMALYTFQRDEGQYLYMYTLG 343

  Fly   263 ----DQGFFKGYDLFVWYLVLLQAGGGLIVAVV--VKYADNILKGFATSLAIIISCVASI----Y 317
                |...:..:..|        .....::|::  |...:.||....|::..|.:...||    :
  Fly   344 KFDWDVSAYSNFKTF--------KSSAYVIAMLLAVPLMNKILGWRDTTIIFIGTWAHSIARLFF 400

  Fly   318 IFDFNLTLQFSFGAGLVIASI 338
            .|..|..|.:   ||.|:.|:
  Fly   401 YFATNTDLLY---AGAVVCSL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 66/345 (19%)
EamA 101..341 CDD:304911 50/262 (19%)
CG42514NP_730171.1 MFS_1 129..458 CDD:284993 67/346 (19%)
MFS 132..495 CDD:119392 67/346 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.