DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and HUT1

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_015080.1 Gene:HUT1 / 855832 SGDID:S000006165 Length:339 Species:Saccharomyces cerevisiae


Alignment Length:343 Identity:67/343 - (19%)
Similarity:127/343 - (37%) Gaps:65/343 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YISLLTLTLQNAILGLSMRYARTRPGDI----FLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKF 84
            |.:.||..|....|.     .||.|..:    |.:..:::.|..|.::..|:|.:.:.....:|.
Yeast    16 YATFLTWALVQEPLA-----TRTWPNSMGKFQFPNVISLIQASVAMMMGYLYLNWKKVEYPPRKM 75

  Fly    85 VRSLHKTIIANPMDTLKVCVPSLVYIVQNN---LLYVSASHLDAATYQVTYQLKILTTAMFAVVI 146
            ::...|.::             |:...|::   |...|..|:|..||.:....|::...:..:::
Yeast    76 IKDHWKQLM-------------LISFTQSSSGPLATTSLKHVDYLTYMLAKSCKMIPVLLVHLLL 127

  Fly   147 LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALG 211
            .|..:.:.:....||:.:|:.:.        |.|...|.....:...||   ..|::.|......
Yeast   128 YRTPIASQKKVVALLVSLGVTIF--------TIGGNDGKKLKRSFNESG---NDNKLQGFGLLFS 181

  Fly   212 ACFLSGFAGIYFEKILK--------------GAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIF 262
            :.||.|......:|:||              ||.:.     ..|:|..|.:.:|...|.|..:..
Yeast   182 SLFLDGLTNATQDKLLKANKAKEKGKQTLITGAHLM-----FTLNLFVILWNILYFIVIDCKQWD 241

  Fly   263 DQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIII-------SCVASIYIFD 320
            :.......|..||..::|.:..|.:....:.|.   |:.|.:.:.|:|       |.:.||.:|.
Yeast   242 NAVSVLTMDPQVWGYLMLYSFCGAMGQCFIFYT---LEQFGSLVLIMITVTRKMVSMILSIIVFG 303

  Fly   321 FNLTLQFSFGAGLVIASI 338
            .::..|...|..:|...|
Yeast   304 KSVRFQQWVGMFIVFGGI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 67/343 (20%)
EamA 101..341 CDD:304911 52/262 (20%)
HUT1NP_015080.1 UAA 7..321 CDD:312076 66/341 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.