DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and YMR253C

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_013980.1 Gene:YMR253C / 855295 SGDID:S000004866 Length:414 Species:Saccharomyces cerevisiae


Alignment Length:309 Identity:64/309 - (20%)
Similarity:115/309 - (37%) Gaps:108/309 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPAPVTYSYSHRTVNAN----------TLKYIS---------LLTLTLQ---NAILGLSMRYART 46
            ||: .|.|.|.:..|:|          ||:.||         |:.||:.   |:.:.:|.:....
Yeast    30 LPS-TTRSLSPKESNSNEDFNVDGNETTLQRISKDYLKPNIGLVLLTVSYFFNSAMVVSTKVLEN 93

  Fly    47 RPGDIF----LSSTAVLMAE--FAKLITCLFLVFNEE-------GK-DAQKFVRSLHKTIIANPM 97
            .|.||.    :....:|:..  ...:.|.:::..|:.       || :.:|::            
Yeast    94 DPDDIANDRQIKPLQILLVRMVITYIGTLIYMYINKSTISDVPFGKPEVRKWL------------ 146

  Fly    98 DTLKVCVPSL-VYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLL 161
             .|:.|.... |:.:..:|:|::.|  ||..  :|:....| |...:.||||.:....:....|:
Yeast   147 -VLRGCTGFFGVFGMYYSLMYLTIS--DAVL--ITFLAPSL-TIFLSWVILRERFTKVEALGSLI 205

  Fly   162 LVMGIVLV-----------------QLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAA 209
            .::|:||:                 |:.::..|.|      ...||            ::|||..
Yeast   206 SLLGVVLIVRPSFLFGTPELTDSSSQIVESSDPKS------RLIAT------------LVGLWGV 252

  Fly   210 LG-ACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIP-FGLLTCFVN 256
            || :|..     |....|.|.|.          :::|:. |.|:|..|:
Yeast   253 LGMSCVY-----IIIRYIGKRAH----------AIMSVSYFSLITAIVS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 59/295 (20%)
EamA 101..341 CDD:304911 38/176 (22%)
YMR253CNP_013980.1 RhaT 119..383 CDD:223769 44/219 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.