DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and YML018C

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_013694.1 Gene:YML018C / 854990 SGDID:S000004480 Length:393 Species:Saccharomyces cerevisiae


Alignment Length:321 Identity:60/321 - (18%)
Similarity:110/321 - (34%) Gaps:92/321 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LVFNEE--GKDAQKFV-------RSLHKTIIANP------MDTLKVCVPSLVYIVQNNLLYVSAS 121
            |:..||  |.|:.:.|       .:|.....||.      .:|:|:.....:.....||:    :
Yeast    84 LIMEEEGTGSDSNRSVDMTSPLLTNLEAGTHANQKKRLTLYETIKLSAEFCILWFTANLV----T 144

  Fly   122 HLDAATYQVTYQLKILTTAMFAVVIL----------RRKLLNTQWGALLLLVMGIVLVQLAQTE- 175
            :...|...|..|..:.||:.|..:.:          :.|:|    |:.:..| ||::|..:.:. 
Yeast   145 NASLAFTSVASQTILSTTSSFFTLFIGAICHVESLSKSKVL----GSFISFV-GIIMVTKSDSHQ 204

  Fly   176 ------GPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILK---GAE 231
                  ...||....|...              ::|...||....|.|    .:..:||   |.|
Yeast   205 RYQRHIADVSGDDNDAVQV--------------LIGNLLALAGAVLYG----VYSTLLKREVGDE 251

  Fly   232 ISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYAD 296
            ..|.|:        |.||.:..|    :.:|........|.|.|....|.....::|.:.|....
Yeast   252 TRVNMK--------IFFGFVGLF----NLLFLWPSLIVLDFFGWEPFSLPKDPKVVVIIFVNCLI 304

  Fly   297 NILKGFATSLAIIISCVASIYIFDFNLTLQ-----------------FSFGAGLVIASIFL 340
            ..:..|..:.|::::...::.: ..::|:.                 :.|||.|::.|.|:
Yeast   305 TFVSDFCWAKAMLLTSPLTVTV-GLSITIPLAMFGDVIFKHKTMSALYLFGATLILGSFFI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 60/321 (19%)
EamA 101..341 CDD:304911 50/277 (18%)
YML018CNP_013694.1 RhaT <142..367 CDD:223769 48/263 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.