DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and YMD8

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_013674.1 Gene:YMD8 / 854970 SGDID:S000004502 Length:442 Species:Saccharomyces cerevisiae


Alignment Length:165 Identity:36/165 - (21%)
Similarity:60/165 - (36%) Gaps:43/165 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 VMGIVLVQLA-QTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIY---- 222
            :|||.|:..: ..|.|..| ...::......|:||...:..:|.:...:....|.|||...    
Yeast   255 IMGITLLLTSLLVEKPFPG-IFSSSIFRLDTSNGGVGTETTVLSIVRGIVLLILPGFAVFLLTIC 318

  Fly   223 -FEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKG------------YDLFV 274
             |..:.:...::|.:..:...||::.||::..    ..|:  .||:..            |:.|.
Yeast   319 EFSILEQTPVLTVSIVGIVKELLTVIFGIIIL----SERL--SGFYNWLGMLIIMADVCYYNYFR 377

  Fly   275 WYLVLLQAGGGLIVAVVVKYAD-------NILKGF 302
            :...|||           ||..       |.||||
Yeast   378 YKQDLLQ-----------KYHSVSTQDNRNELKGF 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 36/165 (22%)
EamA 101..341 CDD:304911 36/165 (22%)
YMD8NP_013674.1 TPT_S35C2 77..371 CDD:411044 24/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.