DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and THI74

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_010726.3 Gene:THI74 / 852048 SGDID:S000002846 Length:370 Species:Saccharomyces cerevisiae


Alignment Length:359 Identity:77/359 - (21%)
Similarity:124/359 - (34%) Gaps:92/359 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKYISL----LTLT------LQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITC------- 69
            |.|:::    |.||      :|:....|..|..||.|     ..|....:||..|::.       
Yeast    46 LTYLNISSFALYLTPDLWRIIQSRRKSLQERTERTLP-----IHTQESFSEFLPLLSSTPSTSSN 105

  Fly    70 LFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQV---- 130
            |..:.:.:.||..:.              :|..||   ::.|.|.....:.|:...|:..:    
Yeast   106 LSSIADTKVKDTMRL--------------SLLFCV---LWFVANLAANAALSYTTVASSTILSST 153

  Fly   131 -TYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASS 194
             ::....|.|::.......:|||     .|.:.:.||:|:.:..::...|.||.......|.|..
Yeast   154 SSFFTLFLATSLGIETFSTKKLL-----GLFVSLFGIILIVMQSSKQQDSVSASSFLVGNTLALL 213

  Fly   195 G--GAPEQNRML-------GLWAALGACFLSGFAGIY----FEKILKGAEISVWMRNVQL-SLLS 245
            |  |......:|       ||  .|......|:.||:    |..||...:|: .|...:| |...
Yeast   214 GSLGYSVYTTLLKYEISSKGL--RLDIQMFLGYVGIFTFLLFWPILIILDIT-HMETFELPSNFH 275

  Fly   246 IPF-GLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAII 309
            |.| .:|.|.:     ||...:|       |...|:.. ..|:|.|.:.        |...||:.
Yeast   276 ISFLVMLNCII-----IFVSDYF-------WCKALILT-SPLVVTVALT--------FTIPLAMF 319

  Fly   310 ISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGY 343
            ...|.....|    |..:..|...:..|.||..:
Yeast   320 ADFVWREAFF----TPWYIIGVIFIFVSFFLVNH 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 77/356 (22%)
EamA 101..341 CDD:304911 57/259 (22%)
THI74NP_010726.3 RhaT <113..354 CDD:223769 61/287 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.