DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and MFSD14B

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_115947.2 Gene:MFSD14B / 84641 HGNCID:23376 Length:506 Species:Homo sapiens


Alignment Length:329 Identity:66/329 - (20%)
Similarity:111/329 - (33%) Gaps:112/329 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 YVSASHLDAATYQVTYQLKILTTAMFAVVI---LRRKLLNTQWGA-------------------- 158
            |:|||:.|:....|...:.:|......|.:   |..|:....|||                    
Human   188 YLSASYGDSLVVLVATVVALLDICFILVAVPESLPEKMRPVSWGAQISWKQADPFASLKKVGKDS 252

  Fly   159 -LLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIY 222
             :||:.:.:.|..|     |.:|.           .|.......:::|..:...|.|:: ..|| 
Human   253 TVLLICITVFLSYL-----PEAGQ-----------YSSFFLYLRQVIGFGSVKIAAFIA-MVGI- 299

  Fly   223 FEKILKGAEISVWMR---NVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGG 284
            ...:.:.|.:|:.||   |....||.:.|.:|            |..:.|:....|   ::.|.|
Human   300 LSIVAQTAFLSILMRSLGNKNTVLLGLGFQML------------QLAWYGFGSQAW---MMWAAG 349

  Fly   285 GL----------IVAVVVKYADNILKGFATSLAIIISCVAS----------IYIFDFNLT----- 324
            .:          |.|:|.:.|::..:|.|..:...|..:.:          .|:|...||     
Human   350 TVAAMSSITFPAISALVSRNAESDQQGVAQGIITGIRGLCNGLGPALYGFIFYMFHVELTELGPK 414

  Fly   325 -------LQ--------FSFGAGLVIAS----IFLYGYDPARSAPKPTMHGPG--------GDEE 362
                   ||        |.|||.:|:.|    :|:..|..|....|.:....|        |.:|
Human   415 LNSNNVPLQGAVIPGPPFLFGACIVLMSFLVALFIPEYSKASGVQKHSNSSSGSLTNTPERGSDE 479

  Fly   363 KLLP 366
            .:.|
Human   480 DIEP 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 59/295 (20%)
EamA 101..341 CDD:304911 59/294 (20%)
MFSD14BNP_115947.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
MFS 48..450 CDD:119392 59/294 (20%)
MFS_1 49..394 CDD:284993 46/238 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 457..481 4/23 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.