DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and UTR3

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_563949.1 Gene:UTR3 / 837998 AraportID:AT1G14360 Length:331 Species:Arabidopsis thaliana


Alignment Length:173 Identity:36/173 - (20%)
Similarity:66/173 - (38%) Gaps:43/173 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 APVTYSYSHRTVNANTLKYISL----LTLTLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKL 66
            ||:.|.          |.:::|    .|...|::|   :.||.:|...||.|...  |......:
plant   170 APLGYG----------LCFLNLAFDGFTNATQDSI---TARYPKTNAWDIMLGMN--LWGTIYNM 219

  Fly    67 ITCLFLVFNEEGKDAQKFVRSLHKTIIANP---MDTLKVCVPSLVYIVQNNLLYVSASHLDAATY 128
            : .:|.:.:..|.:|.:|.:.       :|   .|.|..|   |...|..|.::::.|...:.. 
plant   220 V-YMFGLPHGSGFEAVQFCKQ-------HPEAAWDILMYC---LCGAVGQNFIFLTISRFGSLA- 272

  Fly   129 QVTYQLKILTTAMFAVVILR-----RKLLNTQWGALLLLVMGI 166
                ...|.||..|..:::.     ..|.:.|||.:.::..|:
plant   273 ----NTTITTTRKFVSIVVSSVLSGNPLSSKQWGCVSMVFGGL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 33/161 (20%)
EamA 101..341 CDD:304911 14/71 (20%)
UTR3NP_563949.1 UAA 16..318 CDD:312076 36/173 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.