DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and AT1G12600

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_172720.1 Gene:AT1G12600 / 837816 AraportID:AT1G12600 Length:349 Species:Arabidopsis thaliana


Alignment Length:289 Identity:65/289 - (22%)
Similarity:111/289 - (38%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKIL--TTAMFAVVI-------LRRKLLNT 154
            |.::..|...|:..:.:|..|......:...:.|..:|:  :|.:..|::       ||||....
plant    78 TKQMVNPWKTYVKLSGVLMGSHGLTKGSLAYLNYPAQIMFKSTKVLPVMVMGAFIPGLRRKYPVH 142

  Fly   155 QWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFA 219
            ::.:.:|||:|::|..||......:.|                     ::|:....||..:..|.
plant   143 EYISAMLLVIGLILFTLADAHTSPNFS---------------------IIGVMMISGALIMDAFL 186

  Fly   220 GIYFEKILKGAEISVWMRNVQLS-LLSIPFGLLTCFVNDGSRIFDQGFFKGYDL-----FVWYLV 278
            |...|.|......:..|..:..| ::.:|| ||...:..|.      .|..::.     :|:.::
plant   187 GNLQEAIFTMNPETTQMEMLFCSTVVGLPF-LLAPMILTGE------LFTAWNSCAQHPYVYGVL 244

  Fly   279 LLQAGGGLI--VAVVVKYADNILKGFATSLAI-----IISCVASIYIFDFNLTLQFSFGAGLVIA 336
            :.:|....|  |:|:...|   |.|.||:..|     .::.:.|..||...||.|...|..|:..
plant   245 VFEAMATFIGQVSVLSLIA---LFGAATTAMITTARKAVTLLLSYLIFTKPLTEQHGTGLLLIFM 306

  Fly   337 SIFLYGY-DPARSAPKPTMHGPGGDEEKL 364
            .|.|... ||   .|.|...|.|....||
plant   307 GIILKMVPDP---NPNPKSSGSGQTPGKL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 57/264 (22%)
EamA 101..341 CDD:304911 55/261 (21%)
AT1G12600NP_172720.1 UAA 25..314 CDD:312076 57/266 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.