DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and AT1G06470

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001318934.1 Gene:AT1G06470 / 837159 AraportID:AT1G06470 Length:414 Species:Arabidopsis thaliana


Alignment Length:301 Identity:59/301 - (19%)
Similarity:110/301 - (36%) Gaps:72/301 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 FVRSLHKTIIANPMDTLKVCVPSLVYI-VQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVIL 147
            |||.: .|.:...|| :.:...|||:| |....:..||:.:....:...::|:..:..:|     
plant   145 FVRVV-PTALGTAMD-INLSNESLVFISVTFATMCKSAAPIFLLLFAFAFRLESPSLKLF----- 202

  Fly   148 RRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWA---A 209
                     |.:.::..|::|....:||                            ...|.   .
plant   203 ---------GIISVISAGVLLTVAKETE----------------------------FEFWGFVFV 230

  Fly   210 LGACFLSGF----AGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGY 270
            :.|..:|||    ..:..:|...|.:......:....:::|..|||:..::..|...|..:|...
plant   231 MLAAVMSGFRWCMTQVLLQKETFGLKNPFIFMSCVAPVMAIATGLLSLLLDPWSEFRDNKYFDSG 295

  Fly   271 DLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVAS------IYIFDFNLTLQFSF 329
            ..|.....|:..||.|...:|:  .:.:|....:::.:.|:.|..      :.:|.|:....:..
plant   296 AHFARTCFLMLFGGALAFCMVL--TEYVLVSVTSAVTVTIAGVVKEAVTIVVAVFYFHDEFTWLK 358

  Fly   330 GAGLVI----ASIF-LYGYDPARSAPKPTMHGPGGDEEKLL 365
            |.||:|    .|:| .|.||..:...|.       :|||.|
plant   359 GVGLMIIMVGVSLFNWYKYDKLQKGHKT-------EEEKQL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 51/276 (18%)
EamA 101..341 CDD:304911 45/258 (17%)
AT1G06470NP_001318934.1 TPT 73..373 CDD:281186 50/273 (18%)
EamA <107..216 CDD:279264 18/86 (21%)
EamA 224..374 CDD:304911 31/151 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.