DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and AT5G65000

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_569004.1 Gene:AT5G65000 / 836624 AraportID:AT5G65000 Length:325 Species:Arabidopsis thaliana


Alignment Length:348 Identity:100/348 - (28%)
Similarity:157/348 - (45%) Gaps:63/348 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SHRTVNANTLKYISLLTLTLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEE 77
            |..::....|.|..||||......| :|.|..|.   |:.::| :||..|..|:| |..::....
plant     9 SPSSMGPKVLFYSILLTLQYGAQPL-ISKRCIRK---DVIVTS-SVLTCEIVKVI-CALILMARN 67

  Fly    78 GKDAQKFVRSLHK--TIIANPMDTLKVC-VPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTT 139
            |.     ::.|.|  |:    |.:|... :|:.:|.:||:||.:|...||:.|:.:..|.||..|
plant    68 GS-----LKGLAKEWTL----MGSLTASGLPAAIYALQNSLLQISYRSLDSLTFSILNQTKIFFT 123

  Fly   140 AMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRML 204
            |.|..:|||:|....|.|||.||:|..||:.:.  ||....|:|..|            :|....
plant   124 AFFTFIILRQKQSILQIGALCLLIMAAVLLSVG--EGSNKDSSGINA------------DQKLFY 174

  Fly   205 GLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVN-----DGSRIFDQ 264
            |:...|.|..|||.|....:...:..:.|.::..|::|::    |.|...|:     ||..|...
plant   175 GIIPVLAASVLSGLASSLCQWASQVKKHSSYLMTVEMSIV----GSLCLLVSTLKSPDGEAIKKY 235

  Fly   265 GFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSF 329
            |||.|:.......|:..|.||::|.:|..:|..:.|||....|::::.:           |||:|
plant   236 GFFHGWTALTLVPVISNALGGILVGLVTSHAGGVRKGFVIVSALLVTAL-----------LQFAF 289

  Fly   330 -----------GAGLVIASIFLY 341
                       ...||::||.:|
plant   290 EGKPPSSYCLVALPLVMSSISMY 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 99/343 (29%)
EamA 101..341 CDD:304911 74/256 (29%)
AT5G65000NP_569004.1 Nuc_sug_transp 46..312 CDD:398009 87/305 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D703674at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1127
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.