DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and PUP12

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001318721.1 Gene:PUP12 / 834118 AraportID:AT5G41160 Length:364 Species:Arabidopsis thaliana


Alignment Length:316 Identity:68/316 - (21%)
Similarity:129/316 - (40%) Gaps:68/316 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKT----IIANPMDTLKVCVPS----- 106
            :|:|...::.|:...::...| .:||.|.  .|::.:|.:|    |:..|:..|.....|     
plant    38 VFISIFFLISAQAISVLLGRF-YYNEGGN--SKWISTLVQTGGFPILYLPLSLLPASQSSSSSSS 99

  Fly   107 ------LVYIV--------QNNLLY-VSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQW 156
                  ||:|.        .:|.|| |...:|.|:||.:....::....:|...|..:|:....:
plant   100 SSSFKTLVWIYLSLGFAIGLDNFLYSVGLLYLSASTYSILCASQLAFNGVFYYYINSQKITCLIF 164

  Fly   157 GALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAG- 220
            .::|.|.:..|||.|.......||.:                       .|:.|..||.:.||. 
plant   165 FSVLFLSISAVLVSLDDDSNSPSGDS-----------------------KWSYLIGCFCAVFASL 206

  Fly   221 IY----------FEKILKGAEISVWMR-NVQLSLLSIPFGLLTCFVNDGSRIFD---QGFFKGYD 271
            ||          |||:||...:|:.:. .:..||::....::..|.:....:..   :.|.:|..
plant   207 IYSLQLSLMQFSFEKVLKSETLSMVLEMQIYTSLVASCVAVIGLFASGEWMLLSVEMEEFQEGQV 271

  Fly   272 LFVWYLV--LLQAGGGLIVAV-VVKYADNILKGFATSLAIIISCVASIYIFDFNLT 324
            ::|..||  .:....|.:.|| ::....::.....::|::|::.:|:|.:|...||
plant   272 IYVLTLVGAAVSCQLGCVGAVSLIFLVSSLFSNLISTLSLIVTPLAAIAVFHDKLT 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 68/316 (22%)
EamA 101..341 CDD:304911 55/262 (21%)
PUP12NP_001318721.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.