DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and AT4G35335

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_680766.6 Gene:AT4G35335 / 829687 AraportID:AT4G35335 Length:844 Species:Arabidopsis thaliana


Alignment Length:228 Identity:49/228 - (21%)
Similarity:76/228 - (33%) Gaps:62/228 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIAN 95
            ||.::::..:...|:...||:.::.|....||....|....:....|..||.  ::|.......|
plant    13 TLTDSLVAAAGIIAQETAGDVRMTDTRADEAERGITIKSTGISLYYEMTDAS--LKSFTGARDGN 75

  Fly    96 PMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAV-----------VILRR 149
            .            |::.   |..|..|:|.:: :||..|:|...|:..|           .:||:
plant    76 E------------YLIN---LIDSPGHVDFSS-EVTAALRITDGALVVVDCIEGVCVQTETVLRQ 124

  Fly   150 KL---------LNTQWGALLLL-------------VMGIVLVQLAQTEGPTSGSAGGAAAAATAA 192
            .|         :|......|.|             |:....|.:|..|.|..|.........|.|
plant   125 SLGERIRPVLTVNKMDRCFLELKVDGEEAYQNFQRVIENANVIMATHEDPLLGDVQVYPEKGTVA 189

  Fly   193 SSGGAPEQNRMLGLWAALGACFLSGFAGIYFEK 225
            .|.|       |..||..    |:.||.:|..|
plant   190 FSAG-------LHGWAFT----LTNFAKMYASK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 49/228 (21%)
EamA 101..341 CDD:304911 35/158 (22%)
AT4G35335NP_680766.6 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 141 1.000 Domainoid score I1523
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I1776
OMA 1 1.010 - - QHG57961
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000573
OrthoInspector 1 1.000 - - otm40243
orthoMCL 1 0.900 - - OOG6_100998
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.