DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and UTR2

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001190806.1 Gene:UTR2 / 828400 AraportID:AT4G23010 Length:392 Species:Arabidopsis thaliana


Alignment Length:355 Identity:79/355 - (22%)
Similarity:133/355 - (37%) Gaps:98/355 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LFLVFNEEGKDAQKFVRSLHKTIIANPMDT-LKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQ 133
            |||::      .|.|. :.|   |.|||.| :|:   |.|.:..:.|...|.::|:.....:...
plant    65 LFLIY------LQGFT-TKH---IVNPMRTYVKL---SAVLMGSHGLTKGSLAYLNYPAQIMFKS 116

  Fly   134 LKILTTAMFAVVI--LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGG 196
            .|:|...:....|  ||||....::.:..|||:|::|..||..:...:.|               
plant   117 TKVLPVMIMGAFIPGLRRKYPVHEYISAFLLVLGLILFTLADAQMSPNFS--------------- 166

  Fly   197 APEQNRMLGLWAALGACFLSGFAG-----------------------------IYFEKILKGAEI 232
                  |:|:....||..:..|.|                             ::...:|.|...
plant   167 ------MIGIMMITGALIMDAFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPFLFVPMVLTGEVF 225

  Fly   233 SVWMRNVQLSLLS-------IPFGL------LTCFV---NDGSRIFDQGFFKGY-DLFVWYLVLL 280
            ..|....|.|:||       :.||.      ||.|:   ..|..:..:..|.|: ..:|:.:::.
plant   226 RAWTACAQSSILSESDKEWNLLFGFESTSIDLTRFMIQTGVGLSLEKKSKFVGFLHPYVYGVLVF 290

  Fly   281 QAGGGLI--VAVVVKYADNILKGFATSLAII-----ISCVASIYIFDFNLTLQFSFG-----AGL 333
            :|....|  |:|:...|   |.|.||:..|.     ::.:.|..||...||.|...|     .|:
plant   291 EAMATFIGQVSVLSLIA---LFGAATTALITTARKGVTLLLSYLIFTKPLTEQHGSGLLLIAMGI 352

  Fly   334 VIASIFLYGYDPARSAPKPTMHGPGGDEEK 363
            |:..:.:....||:...:|.:...|||.::
plant   353 VLKMVPMDSKAPAKIPARPAVRIAGGDGDR 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 73/332 (22%)
EamA 101..341 CDD:304911 62/299 (21%)
UTR2NP_001190806.1 UAA 22..359 CDD:285625 73/330 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.