DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and UTR6

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_567083.1 Gene:UTR6 / 825105 AraportID:AT3G59360 Length:405 Species:Arabidopsis thaliana


Alignment Length:410 Identity:94/410 - (22%)
Similarity:173/410 - (42%) Gaps:77/410 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VTYSYSHRTVNANTLKYISLLTLTLQNAIL-GLS--MRYARTRPGDIFLSSTAV-LMAEFAKLI- 67
            ::.:|....:..::.:.:..:.|.:.:.:| ||.  :.|.....|....|..:| .:.|.||:| 
plant    23 ISRAYDDHKIRVSSKQRVLNVLLVVGDCMLVGLQPVLVYMSKVDGKFNFSPISVNFLTEIAKVIF 87

  Fly    68 -TCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVT 131
             ..:.|:.....|..:|.:.|: .|.:....:.:.:.||:|:|.:.|.|.:....:.:.||.::.
plant    88 AIVMLLIQARHQKVGEKPLLSV-STFVQAARNNVLLAVPALLYAINNYLKFTMQLYFNPATVKML 151

  Fly   132 YQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGG 196
            ..||:|..|:...::::|:....||.||.||::||.:.||.                       .
plant   152 SNLKVLVIAVLLKMVMKRRFSIIQWEALALLLIGISVNQLR-----------------------S 193

  Fly   197 APEQNRMLGLWAALGA--C---FLS--GFAGIYFEKILKGA-EISVWMRNVQLSLLSIPF---GL 250
            .||....:|:..|.||  |   |::  ..|.::.|..||.. :.|::::|:.|......|   |:
plant   194 LPEGATAIGIPLATGAYVCTVIFVTVPSMASVFNEYALKSQYDTSIYLQNLFLYGYGAIFNFLGI 258

  Fly   251 LTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVAS 315
            |...:..|...||  ..:|:.....:|:|..|..|::.:...||||.|||.:::::|.|.:.:||
plant   259 LGTVIYKGPGSFD--ILQGHSRATMFLILNNAAQGILSSFFFKYADTILKKYSSTVATIFTGIAS 321

  Fly   316 IYIFDFNLTLQFSFGAGLVIASIFLYGYDP--------------------------------ARS 348
            ..:|...:|:.|..|..:|..|:..: :.|                                |..
plant   322 AALFGHVITMNFLLGISIVFISMHQF-FSPLAKARDEQQQNGNLELGNTKDTHRANESFINMAAG 385

  Fly   349 APKPTMH-GPGGDEEKLLPR 367
            |.:...| |...|...||||
plant   386 ANEEASHRGESDDRTPLLPR 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 83/340 (24%)
EamA 101..341 CDD:304911 66/250 (26%)
UTR6NP_567083.1 Nuc_sug_transp 62..343 CDD:398009 77/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57961
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40243
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.