DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and AT3G59310

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_974458.1 Gene:AT3G59310 / 825100 AraportID:AT3G59310 Length:363 Species:Arabidopsis thaliana


Alignment Length:246 Identity:49/246 - (19%)
Similarity:79/246 - (32%) Gaps:96/246 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 VQNNLLYVSASHLDAATYQVTYQLKILTTAMF-------AVVILRRKLLNTQW-----GALLLLV 163
            |:.|.|.|.|           ||...||:.|.       .|::|....|.|::     ..:.:.:
plant    86 VEANFLVVKA-----------YQYTSLTSVMLLDCWAIPCVLVLTWFYLKTKYRLMKISGVFICI 139

  Fly   164 MGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILK 228
            :|:.:|..:...      ||..|        ||:   |.:.|.:..|....|...:....|.::|
plant   140 VGVFMVVFSDVH------AGDRA--------GGS---NPVKGDFLVLAGATLYAVSNTSEEFLVK 187

  Fly   229 GAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVK 293
            .|:      .|:|...                   .|||                |.:|.|:.|.
plant   188 NAD------TVELMTF-------------------LGFF----------------GAIISAIQVS 211

  Fly   294 YAD-NILK------GFATSLAIIISCVAS--------IYIFDFNLTLQFSF 329
            ..: :.||      |....||:.||.:.|        :|:..|:....|.|
plant   212 ILERDELKAIHWSTGAVGFLAMAISILTSANQRRHILVYLLHFSRFQVFPF 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 49/246 (20%)
EamA 101..341 CDD:304911 49/246 (20%)
AT3G59310NP_974458.1 SLC35F 28..331 CDD:283644 49/246 (20%)
EamA <76..>212 CDD:304911 37/194 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.