DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and AT2G43240

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_181853.3 Gene:AT2G43240 / 818925 AraportID:AT2G43240 Length:406 Species:Arabidopsis thaliana


Alignment Length:360 Identity:89/360 - (24%)
Similarity:161/360 - (44%) Gaps:39/360 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YSYSHRTVNANTLKYISLLTLTLQNAILGLS--MRYARTRPGDIFLSSTAV-LMAEFAKLI-TCL 70
            |:|..|.  ::..:.:::..:.....::||.  :.|.....|....|..:| .:.|.||:| ..:
plant    30 YNYKIRV--SSKQRALNVFLVVGDCMLVGLQPVLVYMSKVDGKFNFSPISVNFLTEIAKVIFAMV 92

  Fly    71 FLVFN-EEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQL 134
            .|:|. ...|..:|.:.|| .|.:....:.:.:.||:.:|.:.|.|.:....:.:.||.::...|
plant    93 MLLFQARHQKVGEKPLLSL-STFVQAARNNMLLAVPAGLYAINNYLKFTMQLYFNPATVKMLSNL 156

  Fly   135 KILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPE 199
            |:|..|:...:|::|:....||.||.||::||.:.||...       ..||...|...::|    
plant   157 KVLVIAVLLKMIMKRRFSIIQWEALALLLIGISINQLRSL-------PEGATTVAVPIATG---- 210

  Fly   200 QNRMLGLWAALGACFL----SGFAGIYFEKILKGA-EISVWMRNVQLSLLSIPF---GLLTCFVN 256
                     |....|:    ...|.:|.|..||.. :.|::::|:.|......|   |:|...:.
plant   211 ---------AYICTFIFVTVPSLASVYNEYALKSQYDTSIYLQNLFLYGYGAIFNFLGILGTVIY 266

  Fly   257 DGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDF 321
            .|...||  ..:|:.....:|:|..|..|::.:...||||.|||.:::::|.|.:.:||..:|..
plant   267 KGPGSFD--ILQGHSRATMFLILNNAAQGILSSFFFKYADTILKKYSSTVATIFTGIASAALFGH 329

  Fly   322 NLTLQFSFGAGLVIASIFLYGYDPARSAPKPTMHG 356
            .||:.|..|..:|..|:..: :.|...|.....:|
plant   330 ILTMNFLLGISIVFISMHQF-FSPLSKAKDEQQNG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 83/336 (25%)
EamA 101..341 CDD:304911 66/247 (27%)
AT2G43240NP_181853.3 EamA 124..345 CDD:304911 65/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57961
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40243
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.