DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and SLC35F5

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001317244.1 Gene:SLC35F5 / 80255 HGNCID:23617 Length:536 Species:Homo sapiens


Alignment Length:242 Identity:52/242 - (21%)
Similarity:85/242 - (35%) Gaps:80/242 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 TTAMFAVVILR-------RKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSG 195
            |.:....||||       .|:||        .:.|:|||.||.:|.|......|:          
Human   297 TLSKLLAVILRLDKEGNGYKILN--------FIGGVVLVNLAGSEKPAGRDTVGS---------- 343

  Fly   196 GAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIP--FGLLTCFVNDG 258
                      :|:..||...:    :|...|.:..:        :...|.||  ||.:..|   .
Human   344 ----------IWSLAGAMLYA----VYIVMIKRKVD--------REDKLDIPMFFGFVGLF---N 383

  Fly   259 SRIFDQGFF----KGYDLF------VWYLVLLQAGGGLIVAVVVKY--------ADNILKGFATS 305
            ..:...|||    .|::.|      |...:::   .|||..|:.::        ..:::...|.|
Human   384 LLLLWPGFFLLHYTGFEDFEFPNKVVLMCIII---NGLIGTVLSEFLWLWGCFLTSSLIGTLALS 445

  Fly   306 LAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY-------GYDP 345
            |.|.:|.:|.:.:.....:..|..||..|..|.|:.       .:||
Human   446 LTIPLSIIADMCMQKVQFSWLFFAGAIPVFFSFFIVTLLCHYNNWDP 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 50/237 (21%)
EamA 101..341 CDD:304911 50/229 (22%)
SLC35F5NP_001317244.1 RhaT <245..483 CDD:223769 50/231 (22%)
EamA 342..483 CDD:279264 34/178 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.