DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Slc35f5

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001343223.1 Gene:Slc35f5 / 74150 MGIID:1921400 Length:546 Species:Mus musculus


Alignment Length:265 Identity:60/265 - (22%)
Similarity:98/265 - (36%) Gaps:73/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 NLLYVSA-SHLDAATYQVTYQLKILTTAMFAVV--------ILRRKLLNTQWGALLLLVMGIVLV 169
            ||.|..| |....|...:......|.|.:.|.|        ....|||     |::|.:.|:|||
Mouse   278 NLSYQEALSDTQVAIVNILSSTSGLFTLILAAVFPSNSGDRFTLSKLL-----AVILSIGGVVLV 337

  Fly   170 QLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISV 234
            .|:.:|    .|||                ::.:..:|:..||.|.:    :|...|.:..:   
Mouse   338 NLSGSE----KSAG----------------RDTIGSIWSLAGAMFYA----VYIVMIKRKVD--- 375

  Fly   235 WMRNVQLSLLSIP--FGLLTCFVNDGSRIFDQGFF----KGYDLFVW---YLVLLQAGGGLIVAV 290
                 :...|.||  ||.:..|   ...:...|||    .|::.|.:   .::|.....|||..|
Mouse   376 -----REDKLDIPMFFGFVGLF---NLLLLWPGFFLLHYTGFEDFEFPNKVVLLCIIINGLIGTV 432

  Fly   291 VVKY--------ADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLY------ 341
            :.::        ..:::...|.||.|.:|.:|.:.:.....:..|..||..|..|.|:.      
Mouse   433 LSEFLWLWGCFLTSSLIGTLALSLTIPLSIIADMCMQKVQFSWLFFAGAIPVFFSFFIVTLLCHY 497

  Fly   342 -GYDP 345
             .:||
Mouse   498 NNWDP 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 58/260 (22%)
EamA 101..341 CDD:304911 58/252 (23%)
Slc35f5NP_001343223.1 RhaT <268..493 CDD:223769 58/254 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.