DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Slc35f2

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_006511523.1 Gene:Slc35f2 / 72022 MGIID:1919272 Length:430 Species:Mus musculus


Alignment Length:349 Identity:65/349 - (18%)
Similarity:116/349 - (33%) Gaps:124/349 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 IANPM--DTLKVCVPSLVYIV-------QNNLLY----------------VSASHLDAATYQVTY 132
            :..||  ..:..|:..|||.:       .:|||.                |.|::|....||.|.
Mouse   124 VNTPMLQSFINYCLLFLVYTLMLAFQSGSDNLLEILRRKWWKYTLLGLADVEANYLIVRAYQYTT 188

  Fly   133 QLKILTTAMFAV--------VILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAA 189
            ...:.....|.:        .|||.:.....:.|:.:.::|:             |:..||...|
Mouse   189 LTSVQLLDCFGIPVLMALSWFILRARYKVIHFIAVFVCLLGV-------------GTMVGADILA 240

  Fly   190 TAASSGGAPEQNRMLG---------LWAALGAC------------FLSGFAGIYFEKILKGAEIS 233
            ....:.|:   :.::|         |:|....|            || |..|: |..|:.|.::.
Mouse   241 GREDNSGS---DVLIGDILVLLGASLYAVSNVCEEYIVKKLSRQEFL-GMVGL-FGTIISGIQLL 300

  Fly   234 V----------WMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIV 288
            :          |  :.:::||.:.|.|  |                  :|..|..:     .|::
Mouse   301 IVEYKDIARIQW--DWKIALLFVAFAL--C------------------MFCLYSFM-----PLVI 338

  Fly   289 AVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPARSAPKPT 353
            .|....:.|:  |..|  |.:.|....:::|::..:..:.....:::....||...|.|:...|.
Mouse   339 KVTSATSVNL--GILT--ADLYSLFFGLFLFEYKFSGLYILSFTVIMVGFILYCSTPTRTVEPPE 399

  Fly   354 MHGP-----GGD------EEKLLP 366
            ...|     |.|      ||..||
Mouse   400 SSVPPVTSIGIDNLGLKLEESGLP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 54/312 (17%)
EamA 101..341 CDD:304911 51/301 (17%)
Slc35f2XP_006511523.1 SLC35F 92..389 CDD:283644 55/313 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.