DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Mfsd14b

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001077370.1 Gene:Mfsd14b / 66631 MGIID:1913881 Length:507 Species:Mus musculus


Alignment Length:315 Identity:67/315 - (21%)
Similarity:112/315 - (35%) Gaps:69/315 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQL 134
            :||.|...|......:..||:|.   |..|.  .:..|:..|:..|.::||..:.|.:.....:.
Mouse    54 IFLEFFAWGLLTTPMLTVLHETF---PQHTF--LMNGLIQGVKGLLSFLSAPLIGALSDVWGRKP 113

  Fly   135 KILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQ--------TEGPTSGSAGGAAAAATA 191
            .:|.|..|....:....:|..|...::.|.|:..|..:.        |:.....:|.|..:|..|
Mouse   114 FLLGTVFFTCFPIPLMRINPWWYFGMISVSGVFSVTFSVIFAYVADFTQEHERSTAYGWVSATFA 178

  Fly   192 ASSGGAPEQNRMLG-------------LWAALGACF-LSGFAGIYFEKILK---GAEISVWMRNV 239
            ||...:|.....|.             |.|.|..|| |........|||..   ||:|| |.:  
Mouse   179 ASLVSSPAIGTYLSANYGDSLVVLVATLVALLDICFILIAVPESLSEKIRPASWGAQIS-WKQ-- 240

  Fly   240 QLSLLSIPFG-----------LLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVK 293
                 :.||.           ||.|.....|.:.:.|.:..:  |::...::..|...|||.:  
Mouse   241 -----ADPFASLKKVGKDSTVLLICITVFLSYLPEAGQYSSF--FLYLRQVIGFGSVKIVAFI-- 296

  Fly   294 YADNILKGFATSLAIIISCVA-SIYIFDFNLTL----QFSFGAGLVIASIFLYGY 343
                       ::..|:|.|| ::::.....:|    ....|.|..:..:..||:
Mouse   297 -----------AMVGILSIVAQTVFLSKLMRSLGNKNTVLLGLGFQMLQLAWYGF 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 65/312 (21%)
EamA 101..341 CDD:304911 56/280 (20%)
Mfsd14bNP_001077370.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
MFS_MFSD14 47..452 CDD:340945 67/315 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 459..483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.