DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and slc22a18

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001032462.1 Gene:slc22a18 / 559752 ZFINID:ZDB-GENE-051120-165 Length:400 Species:Danio rerio


Alignment Length:215 Identity:42/215 - (19%)
Similarity:80/215 - (37%) Gaps:38/215 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFE 224
            |:||:..:..|......|.|...|.:.:.....      |..|::.         ..|.|..:..
Zfish   174 LMLVLNFIPKQTKTQTTPESDEKGSSKSVFNMG------EITRLMK---------FPGVAKTFTV 223

  Fly   225 KILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVA 289
            ||:.|....::  .|..|::::.|..|....|            ||.:..:.:|.:...|.:|..
Zfish   224 KIISGLPTGIF--QVMFSIIAMNFFQLKAEQN------------GYLMAYFGIVQMVIQGAVIGR 274

  Fly   290 VVVKYADNIL----KGFATSLAIIISCVASIYIFDF-NLTLQFSFGAGLVIA-SIFLYGYDPARS 348
            :...:::|.|    .|.::.:.:..:.:.:::.|.| .:.:.||.....||. |:......||.:
Zfish   275 LTSSFSENSLLLLSVGVSSLVGLAQALMTNVFQFCFIVIPMMFSLSVFNVITDSMLTKSVSPADT 339

  Fly   349 APKPTMHGPGGDEEKLLPRV 368
            .   ||.|.....:.||..|
Zfish   340 G---TMLGLCASVQSLLRTV 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 34/187 (18%)
EamA 101..341 CDD:304911 34/186 (18%)
slc22a18NP_001032462.1 MFS 10..389 CDD:119392 42/215 (20%)
MFS_1 10..358 CDD:284993 42/215 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.