DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and slc35a3a

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001116721.1 Gene:slc35a3a / 559707 ZFINID:ZDB-GENE-081105-80 Length:328 Species:Danio rerio


Alignment Length:336 Identity:163/336 - (48%)
Similarity:218/336 - (64%) Gaps:22/336 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKYISLLTLTLQNAILGLSMRYARTRPGD--IFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKF 84
            |||:||..|..|...|.|:|||:||..||  .:|:|:||::|||.|::||:.|||.|.....:..
Zfish     6 LKYLSLGVLVFQTTSLVLTMRYSRTLQGDGPRYLASSAVVVAEFLKILTCVGLVFKENSYSGRAL 70

  Fly    85 VRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRR 149
            ...:.:.||..|::|||:.:||.:|.:|||||||:.|:||||||||||||||||||:|:|.:|.|
Zfish    71 SSIMRQEIIHKPVETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGR 135

  Fly   150 KLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACF 214
            :|...||.:||:|:.|:..||     .||...|.......||.|        :.:||.|.|.||.
Zfish   136 RLGVYQWLSLLILMAGVAFVQ-----WPTDSPADPQKEHLTAGS--------QFVGLVAVLVACC 187

  Fly   215 LSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVL 279
            .|||||:|||||||..:.|||:||:||.|..:.||:......||.|:.:.|.|:||:...|.:|.
Zfish   188 SSGFAGVYFEKILKETKQSVWVRNIQLGLFGLVFGVFGMLAYDGDRVREHGMFQGYNTLTWIVVA 252

  Fly   280 LQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIF-DFNLTLQFSFGAGLVIASIFLYGY 343
            |||.|||::|.|:||||||||||||||:||:|.:.|.::. ||..|..|..||.|||.:.|||||
Zfish   253 LQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFLLEDFEPTSVFFLGAILVIMATFLYGY 317

  Fly   344 D------PARS 348
            :      |:|:
Zfish   318 ENKPPSNPSRA 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 158/322 (49%)
EamA 101..341 CDD:304911 122/240 (51%)
slc35a3aNP_001116721.1 Nuc_sug_transp 2..316 CDD:282054 158/322 (49%)
nst 87..315 CDD:129885 122/240 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D540031at33208
OrthoFinder 1 1.000 - - FOG0000573
OrthoInspector 1 1.000 - - otm26118
orthoMCL 1 0.900 - - OOG6_100998
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R502
SonicParanoid 1 1.000 - - X1127
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.