DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and slc35f2l

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_017206555.2 Gene:slc35f2l / 559645 ZFINID:ZDB-GENE-130530-1004 Length:389 Species:Danio rerio


Alignment Length:283 Identity:52/283 - (18%)
Similarity:86/283 - (30%) Gaps:90/283 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 VSASHLDAATYQVTYQLKILTTAMFAV---VILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTS 179
            |.|::.....||.|....|.....|.:   :||....|.|::..:....:||.|           
Zfish   116 VEANYAVVKAYQYTTLTSIQLLDCFIIPVLMILSWFFLKTRYRIIHYAAVGICL----------- 169

  Fly   180 GSAGGAAAAATAASSGGAPEQNRMLG---------LWAALGAC------------FLSGFAGIYF 223
            ...|....|...|........:.:||         |:|....|            || |..|: |
Zfish   170 AGVGAMVGADILAGQDQGSSSDVLLGDGLVLVSATLYAISNVCQEYTVKNLSRVEFL-GMVGL-F 232

  Fly   224 EKILKGAEISVW----MRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGG 284
            ..|:...::.:.    :.|:|                                :.|...||.:|.
Zfish   233 GSIISAIQLGILEHKEVANIQ--------------------------------WTWEKALLLSGY 265

  Fly   285 GL-------IVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASI--FL 340
            .|       .:.||:|.:.......:.....:.|....:::|.:|.       :||.|.|:  .|
Zfish   266 ALCMYGFYSFMPVVIKRSSATAVNLSLLTGDLFSLFFGLFLFHYNF-------SGLYIVSLVGIL 323

  Fly   341 YGYDPARSAPK-PTMHGPGGDEE 362
            .|:....:.|. ..:..|..|||
Zfish   324 IGFIMFNTVPTLSRLSDPLSDEE 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 46/260 (18%)
EamA 101..341 CDD:304911 45/259 (17%)
slc35f2lXP_017206555.2 SLC35F 32..329 CDD:283644 47/264 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.