DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and mfsd14ba

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_002663499.2 Gene:mfsd14ba / 557306 ZFINID:ZDB-GENE-200414-1 Length:500 Species:Danio rerio


Alignment Length:192 Identity:41/192 - (21%)
Similarity:76/192 - (39%) Gaps:27/192 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVT 131
            :..:||.|...|......:..||:|.   |..|.  .:..|:..|:..|.::||..:.|.:....
Zfish    53 VVVIFLEFFAWGLLTTPMLTVLHETF---PTHTF--LINGLIQGVKGLLSFMSAPLIGALSDVWG 112

  Fly   132 YQLKILTTAMFAVVILRRKLLNTQWGALLLLVMG-------IVLVQLAQ-TEGPTSGSAGGAAAA 188
            .:..:|.|..|....:....|:..|...::.|.|       ::...:|. |:.....:|.|..:|
Zfish   113 RRSFLLVTVFFTCAPIPLMRLSPWWYFAMISVSGAFSVTFSVIFAYIADVTDERERSTAYGLVSA 177

  Fly   189 ATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGL 250
            ..|||...:|          |:|| :||   ..|.:.::......:.:.::...||::|..|
Zfish   178 TFAASLVTSP----------AIGA-YLS---ASYGDNLVVLVATLIALADICFILLAVPESL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 41/192 (21%)
EamA 101..341 CDD:304911 32/158 (20%)
mfsd14baXP_002663499.2 MFS 52..409 CDD:119392 41/192 (21%)
MFS_1 54..398 CDD:284993 41/191 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.