DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and slc35f2

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001070024.1 Gene:slc35f2 / 555929 ZFINID:ZDB-GENE-030131-5516 Length:396 Species:Danio rerio


Alignment Length:372 Identity:66/372 - (17%)
Similarity:116/372 - (31%) Gaps:124/372 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 FVRSLHKTIIANPMDTLKVCVPSLV--YIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI 146
            |...|.|||......::.:|..::.  |:.::....:..|.|:       |.|.:||...  |:.
Zfish    37 FTWQLFKTIAMGQALSMLICGTAVTCQYLAKDVETPMLQSFLN-------YSLLLLTYTF--VLA 92

  Fly   147 LRR------KLLNTQWGALLLLVM-----GIVLVQLAQTEGPTS--------------------- 179
            |||      ::|.|:|....|:.:     ...:|:..|....||                     
Zfish    93 LRRGENNIVQILKTKWWKYFLMALTDVEANYTVVKAYQFTTLTSIQLLDCFVIPVLMVLSWIFLK 157

  Fly   180 ---------------GSAGGAAAAATAASSGGAPEQNRMLG---------LWAALGAC------F 214
                           ...|....|...|........:.:||         |:|....|      .
Zfish   158 TRYRPWHFVSVAVCLFGVGAMVGADLLAGRDQGSSSHVLLGDGLVLVSAALYAVSNVCQEYTVKN 222

  Fly   215 LS-----GFAGIYFEKILKGAEISVWMRNVQLSLLSIP---FGLLTCFVNDGSRIFDQGFFKGYD 271
            ||     |..|: |..::.|.::::      |...:||   :....|.:           |..|.
Zfish   223 LSRVEYIGMIGL-FGTLISGVQMAI------LEYKAIPAINWDWQKCLL-----------FFAYT 269

  Fly   272 LFVWYLVLLQAGGGL--IVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLV 334
            |.::         ||  .|.||||.........:...|.:.|....|::|.:..|..:.....::
Zfish   270 LCMY---------GLYSFVPVVVKMTSATAVNLSLLTADLFSLFCGIFLFGYKFTGLYIVSLVVI 325

  Fly   335 IASIFLYGYDPARSAPKPTMHG-------------PGGD-EEKLLPR 367
            :....::...|..:|.:..::.             .||| .|..||:
Zfish   326 MVGFVMFNVVPTFTADQSHVNNDVVYHLDSSANYQQGGDIVENCLPK 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 58/331 (18%)
EamA 101..341 CDD:304911 53/313 (17%)
slc35f2NP_001070024.1 SLC35F 37..334 CDD:283644 58/332 (17%)
EamA <109..>264 CDD:304911 23/161 (14%)
EamA 196..334 CDD:279264 30/164 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.