DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and slc35f1

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_682935.5 Gene:slc35f1 / 555352 ZFINID:ZDB-GENE-060503-463 Length:388 Species:Danio rerio


Alignment Length:403 Identity:79/403 - (19%)
Similarity:138/403 - (34%) Gaps:135/403 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PVTYSYSHRTVNANTLKYISLLTLTLQNAI------LGLSMRYARTRPGDIFLSSTAVLMAEFAK 65
            |..|....:.:|...     :|||.|...:      :||:.:|.    .|.:.::|.|..: |..
Zfish    26 PSLYQRMKKVLNREL-----VLTLALGQVLSLLICGIGLTSKYL----ADDYHANTPVFQS-FLN 80

  Fly    66 LITCLFLVFN-----EEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQN--------NLLY 117
            .| .||||:.     .:|::                         :|:.|::.        .|:.
Zfish    81 YI-LLFLVYTTTLAVRQGEE-------------------------NLLAILKRRWWKYMILGLID 119

  Fly   118 VSASHLDAATYQVT--YQLKILTTAMFAVVIL--------RRKLLNTQWGALLLLVMGI-----V 167
            :.|::|....||.|  ..:::|...:..||:|        |.|:|:.....:.||.||.     |
Zfish   120 IEANYLVIKAYQYTTLTSVQLLDCFVIPVVLLLSWFFLLVRYKVLHFVGVGVCLLGMGCMVGADV 184

  Fly   168 LVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEI 232
            ||...|..|                       .:::||....||...|.|.:.:..|.|:|    
Zfish   185 LVGRQQGLG-----------------------DHKLLGDLLVLGGATLYGISNVCEEFIVK---- 222

  Fly   233 SVWMRNVQLSLLSIPF-GLLTCFVNDGSRIFDQGFFKGYDLFV------------WYLVLLQAG- 283
                     :|..:.| |::..|   ||      ||.|..|.:            |.:.||..| 
Zfish   223 ---------NLSRVEFLGMMGLF---GS------FFSGIQLAIMEHKELLKVQWDWQIGLLYIGF 269

  Fly   284 ----GGL--IVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYG 342
                .||  .:.||:|.........:...|.:.|....:::|.:..:..:.....:::..:.||.
Zfish   270 SACMFGLYSFMPVVIKRTSATAVNLSLLTADLYSLFCGLFLFQYKFSGLYLLSFFIIVLGLVLYS 334

  Fly   343 YDPARSAPKPTMH 355
            ......|..|.::
Zfish   335 SSSTYVAQDPRVY 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 74/377 (20%)
EamA 101..341 CDD:304911 55/282 (20%)
slc35f1XP_682935.5 SLC35F 36..335 CDD:283644 75/379 (20%)
EamA <110..>191 CDD:304911 20/80 (25%)
EamA 203..334 CDD:279264 30/152 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.