DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and slc35a3b

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001017900.1 Gene:slc35a3b / 550599 ZFINID:ZDB-GENE-050417-460 Length:364 Species:Danio rerio


Alignment Length:333 Identity:159/333 - (47%)
Similarity:220/333 - (66%) Gaps:18/333 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ANTLKYISLLTLTLQNAILGLSMRYARTRPGD--IFLSSTAVLMAEFAKLITCLFLVFNEEGKDA 81
            ::.|||.||..|..|...|.|:|||:||...:  ::|:|:||:.||..|::.|:.|||.:.....
Zfish    39 SSRLKYASLGVLVFQTTTLVLTMRYSRTLHTEEPLYLASSAVVCAELLKIVACILLVFRDHSFSV 103

  Fly    82 QKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVI 146
            :.....|.:.||..|:.|||:.:||.:|.:|||||||:.|:||||||||||||||||||:|:|.:
Zfish   104 RSLNLVLKEEIINRPLLTLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSM 168

  Fly   147 LRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALG 211
            |.::|...||.:|::|::||.|||     .||..|:.......||:|        :::||.|.|.
Zfish   169 LGKRLGIYQWLSLVILMIGIALVQ-----WPTEVSSSTGEKDLTASS--------QLIGLLAVLV 220

  Fly   212 ACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWY 276
            |||.|||||:|||||||.::.|||:||:||.|..:.||....|..|..|:.:.|.|:||:...|.
Zfish   221 ACFSSGFAGVYFEKILKESKQSVWVRNIQLGLFGLVFGFGGVFTYDRERVLENGLFQGYNNVTWS 285

  Fly   277 LVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIF-DFNLTLQFSFGAGLVIASIFL 340
            :|.|||.|||::|.|:|||||||||||||::||:|.:.|.::. ||:.|..|..||.||||:.||
Zfish   286 VVALQALGGLVIAAVIKYADNILKGFATSISIILSTLISYFLLDDFDPTSVFFLGAMLVIAATFL 350

  Fly   341 YGYD--PA 346
            ||.:  ||
Zfish   351 YGCERTPA 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 155/325 (48%)
EamA 101..341 CDD:304911 123/240 (51%)
slc35a3bNP_001017900.1 Nuc_sug_transp 38..352 CDD:282054 155/325 (48%)
nst 123..351 CDD:129885 123/240 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D540031at33208
OrthoFinder 1 1.000 - - FOG0000573
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100998
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R502
SonicParanoid 1 1.000 - - X1127
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.