DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and cox4i1

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001016479.1 Gene:cox4i1 / 549233 XenbaseID:XB-GENE-953648 Length:169 Species:Xenopus tropicalis


Alignment Length:62 Identity:18/62 - (29%)
Similarity:23/62 - (37%) Gaps:10/62 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 EKILKGAEISVW---MRNVQLSLLSIPFGLLTCFVNDGSR-----IFDQGFFKGYDLFV--W 275
            :|.||..|...|   ....:|.|..|.|......:|.||.     :....||.|:..||  |
 Frog    59 QKALKEKEKGTWASLSAKEKLELYRIKFQESYSEMNQGSSEWKTILGGTLFFIGFTAFVILW 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 18/62 (29%)
EamA 101..341 CDD:304911 18/62 (29%)
cox4i1NP_001016479.1 COX4 36..168 CDD:367258 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.