DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and SLC35F2

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_059985.2 Gene:SLC35F2 / 54733 HGNCID:23615 Length:374 Species:Homo sapiens


Alignment Length:373 Identity:65/373 - (17%)
Similarity:126/373 - (33%) Gaps:137/373 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 AEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPS------------------- 106
            |||:.|:..:      :||   .|..::.|||....|.:|.:|..:                   
Human    21 AEFSSLLRRI------KGK---LFTWNILKTIALGQMLSLCICGTAITSQYLAERYKVNTPMLQS 76

  Fly   107 --------LVYIV-------QNNLLY----------------VSASHLDAATYQVTYQLKILTTA 140
                    |:|.|       .:|||.                |.|:::....||.|....:....
Human    77 FINYCLLFLIYTVMLAFRSGSDNLLVILKRKWWKYILLGLADVEANYVIVRAYQYTTLTSVQLLD 141

  Fly   141 MFAVVILRRK---LLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNR 202
            .|.:.:|...   :|:.::..:..:.:.:.|:.:        |:..||...|....:.|:   :.
Human   142 CFGIPVLMALSWFILHARYRVIHFIAVAVCLLGV--------GTMVGADILAGREDNSGS---DV 195

  Fly   203 MLG---------LWAALGAC------------FLSGFAGIYFEKILKGAEISV----------WM 236
            ::|         |:|....|            || |..|: |..|:.|.::.:          | 
Human   196 LIGDILVLLGASLYAISNVCEEYIVKKLSRQEFL-GMVGL-FGTIISGIQLLIVEYKDIASIHW- 257

  Fly   237 RNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKG 301
             :.:::||.:.|.|  |                  :|..|..:     .|::.|....:.|:  |
Human   258 -DWKIALLFVAFAL--C------------------MFCLYSFM-----PLVIKVTSATSVNL--G 294

  Fly   302 FATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPARSA 349
            ..|  |.:.|....:::|.:..:..:.....:::....||...|.|:|
Human   295 ILT--ADLYSLFVGLFLFGYKFSGLYILSFTVIMVGFILYCSTPTRTA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 61/364 (17%)
EamA 101..341 CDD:304911 48/323 (15%)
SLC35F2NP_059985.2 SLC35F 35..334 CDD:283644 56/342 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.