DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and SLC35B3

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001136012.1 Gene:SLC35B3 / 51000 HGNCID:21601 Length:401 Species:Homo sapiens


Alignment Length:377 Identity:78/377 - (20%)
Similarity:127/377 - (33%) Gaps:99/377 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NTLKYISLL----TLTLQN--------AILGLSM-RYARTRPGDIFLSSTAVLMAEFAKLITCLF 71
            |:.||||:.    |.|:..        .:||::: ::.:.....|.::...|....:..|..   
Human    39 NSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNLSKFNKLTQFFICVAGVFVFYLIYGYLQE--- 100

  Fly    72 LVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKI 136
            |:|:.||..:..:..:|           ::....|:..:::..|:......:...||.:...|.:
Human   101 LIFSVEGFKSCGWYLTL-----------VQFAFYSIFGLIELQLIQDKRRRIPGKTYMIIAFLTV 154

  Fly   137 LTTAMFAVVILRRKLLNTQWG-------------ALLLLVMGIVLVQLAQTEGPTSGSAGGAAAA 188
            .|..          |.||..|             .|:.:::|.|.:|     |.....|..:||.
Human   155 GTMG----------LSNTSLGYLNYPTQVIFKCCKLIPVMLGGVFIQ-----GKRYNVADVSAAI 204

  Fly   189 A--------TAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLS 245
            .        |.|.|..||..|....:..:|..| .....|...||.:|....|    |.::.|.|
Human   205 CMSLGLIWFTLADSTTAPNFNLTGVVLISLALC-ADAVIGNVQEKAMKLHNAS----NSEMVLYS 264

  Fly   246 IPFGL------LTCFVNDGS----------RIFDQGF---FKGYDLFVWYLVLLQAGGGLIVAVV 291
            ...|.      |||....|.          |.:...|   ..||....:.|.|::..|.||...|
Human   265 YSIGFVYILLGLTCTSGLGPAVTFCAKNPVRTYGYAFLFSLTGYFGISFVLALIKIFGALIAVTV 329

  Fly   292 VKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGY 343
                        |:....::.|.|...|....|.|:.:...||:..|||..|
Human   330 ------------TTGRKAMTIVLSFIFFAKPFTFQYVWSGLLVVLGIFLNVY 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 77/374 (21%)
EamA 101..341 CDD:304911 59/279 (21%)
SLC35B3NP_001136012.1 UAA 80..371 CDD:312076 69/336 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.