DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Slc35f1

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001102808.1 Gene:Slc35f1 / 502421 RGDID:1559576 Length:408 Species:Rattus norvegicus


Alignment Length:425 Identity:95/425 - (22%)
Similarity:151/425 - (35%) Gaps:143/425 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPAP----VTYSYSHR---------TVNANTLKYISL-LTLTLQNAILGLSMRYARTRPGDIFLS 54
            |||.    |:.|.|.|         .:|...|..::| ..|:|....:||:.:|.    .:.|.:
  Rat    30 LPAEGSGCVSLSTSSRAGMRQRIRKVLNREMLISVALGQVLSLLVCGIGLTSKYL----AEDFHA 90

  Fly    55 STAVLMAEFAKLITCLFLVFN-----EEGKDAQKFV--RSLHKTIIANPMDTLKVCVPSLVYIVQ 112
            :|.|..: |...| .||||:.     .:|::....:  |...|.:|...:|              
  Rat    91 NTPVFQS-FLNYI-LLFLVYTTTLAVRQGEENLLAILRRRWWKYMILGFID-------------- 139

  Fly   113 NNLLYVSASHLDAATYQVT--YQLKILTTAMFAVVILRRKLLNTQWGALLLL-----VMGIVLVQ 170
                 :.|::|....||.|  ..:::|...:..||||      ..|..||:.     .:|||:..
  Rat   140 -----LEANYLVVKAYQYTTLTSVQLLDCFVIPVVIL------LSWFFLLIRYKAVHFIGIVVCI 193

  Fly   171 LAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVW 235
            |..      |...||..........|   :|:::|....||...|.|.:.::.|.|::       
  Rat   194 LGM------GCMVGADVLVGRHQGAG---ENKLVGDLLVLGGATLYGISNVWEESIIR------- 242

  Fly   236 MRNVQLSLLSIPF-GLLTCFVNDGSRIFDQGFFKGYDLFV------------WYLVLLQAG---- 283
                  :|..:.| |::..|         ..||.|..|.:            |.:.||..|    
  Rat   243 ------TLSRVEFLGMIGLF---------GAFFSGIQLAIMEHKELLKVPWDWQIGLLYVGFSAC 292

  Fly   284 -GGL--IVAVVVKYADNILKGFATSL------AIIISCVASIYIFDFNLTLQFSFGAGLVIASIF 339
             .||  .:.||:|      |..|||:      |.:.|....:::|.:    :||   ||.:.|.|
  Rat   293 MFGLYSFMPVVIK------KTSATSVNLSLLTADLYSLFCGLFLFHY----KFS---GLYLLSFF 344

  Fly   340 -------LYGYDPARSAPKPTMH-------GPGGD 360
                   ||.......|..|.::       ||..|
  Rat   345 TILIGLVLYSSTSTYIAQDPRVYKQFRNPSGPVSD 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 82/371 (22%)
EamA 101..341 CDD:304911 59/279 (21%)
Slc35f1NP_001102808.1 SLC35F 56..355 CDD:283644 83/373 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.