DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Slc35b2

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001032292.1 Gene:Slc35b2 / 501103 RGDID:1565318 Length:431 Species:Rattus norvegicus


Alignment Length:342 Identity:66/342 - (19%)
Similarity:128/342 - (37%) Gaps:67/342 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ISLLTL-TLQNAILGLSMRYARTRPGDIFLSST-AVLMAEFAKLITC-LFLVFNEEGKDAQKFVR 86
            :|.||. .||..::..|.....|.||:.|..|. .|||.....|:.. |:.:..::.:...    
  Rat   121 VSYLTWGVLQERVMTGSYGATATSPGEHFTDSQFLVLMNRVLALVVAGLYCILRKQPRHGA---- 181

  Fly    87 SLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKL 151
                     ||  .:....||..::.:...|.:...:...|..:....|::...|...::.||..
  Rat   182 ---------PM--YRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMMMGKLVSRRSY 235

  Fly   152 LNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLS 216
            .:.::....|:.:|:.:..|:....|.|       :.||..|                 |...|:
  Rat   236 EHWEYLTAGLISIGVSMFLLSSGPEPRS-------SPATTLS-----------------GLVLLA 276

  Fly   217 GFAGIYFEKILKGAEISVWMRNVQLSLLSIPFG--LLTCFVNDGSRIFDQG-------FFKGYDL 272
            |:  |.|:......:.:::.  .::|.:.:.||  |.:|....|| :.:||       |...:..
  Rat   277 GY--IAFDSFTSNWQDALFA--YKMSSVQMMFGVNLFSCLFTVGS-LLEQGALLEGARFMGRHSE 336

  Fly   273 FVWYLVLL---QAGGGLIVAVVV----KYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFG 330
            |..:.:||   .|.|.|.:...:    .....|:.....::||::||:    ::...:|:....|
  Rat   337 FALHALLLSVCSAFGQLFIFYTIGQFGAAVFTIIMTLRQAIAILLSCL----LYGHTVTVVGGLG 397

  Fly   331 AGLVIASIFLYGYDPAR 347
            ..:|..::.|..|...|
  Rat   398 VAVVFTALLLRVYARGR 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 64/335 (19%)
EamA 101..341 CDD:304911 45/255 (18%)
Slc35b2NP_001032292.1 UAA 111..412 CDD:285625 65/338 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.