powered by:
Protein Alignment Ugalt and slc35e2b
DIOPT Version :9
Sequence 1: | NP_001138149.1 |
Gene: | Ugalt / 31255 |
FlyBaseID: | FBgn0024994 |
Length: | 368 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001011387.1 |
Gene: | slc35e2b / 496855 |
XenbaseID: | XB-GENE-992208 |
Length: | 124 |
Species: | Xenopus tropicalis |
Alignment Length: | 42 |
Identity: | 15/42 - (35%) |
Similarity: | 21/42 - (50%) |
Gaps: | 4/42 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 206 LWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIP 247
||.....|.| |...|...:|:| |.|: :...|:.|||:|
Frog 82 LWFFFSFCTL--FLNKYILTLLEG-EPSM-LGKYQVILLSLP 119
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.