DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and slc35e2b

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001011387.1 Gene:slc35e2b / 496855 XenbaseID:XB-GENE-992208 Length:124 Species:Xenopus tropicalis


Alignment Length:42 Identity:15/42 - (35%)
Similarity:21/42 - (50%) Gaps:4/42 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 LWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIP 247
            ||.....|.|  |...|...:|:| |.|: :...|:.|||:|
 Frog    82 LWFFFSFCTL--FLNKYILTLLEG-EPSM-LGKYQVILLSLP 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 15/42 (36%)
EamA 101..341 CDD:304911 15/42 (36%)
slc35e2bNP_001011387.1 TPT 74..>112 CDD:331565 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.