DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and slc35a1

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_012818384.1 Gene:slc35a1 / 496449 XenbaseID:XB-GENE-1001033 Length:338 Species:Xenopus tropicalis


Alignment Length:320 Identity:132/320 - (41%)
Similarity:198/320 - (61%) Gaps:18/320 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KYISLLTLTLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRS 87
            |...||.:||..|...:.:||.||...:::.|:|||.:.|..||:..:.::..|.| ...:.:.|
 Frog    12 KLYCLLVMTLIAAAYTVVLRYTRTATKEMYFSTTAVCITEVIKLLLSVCILAKETG-SLSRLITS 75

  Fly    88 LHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLL 152
            |...::.:|::.||:.||||||.:|||:.:|:.|:||||.|||||||||..||:..|::|.|.|.
 Frog    76 LKDNVLGSPVEMLKLSVPSLVYALQNNMAFVALSNLDAAVYQVTYQLKIPCTALCTVLMLNRSLN 140

  Fly   153 NTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSG 217
            ..||.::.:|..|:.|||.:..|             ||....    |||.:||:.|...|...||
 Frog   141 KLQWVSVFILCGGVTLVQYSPAE-------------ATKVQI----EQNYLLGIGAVAIAVLCSG 188

  Fly   218 FAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQA 282
            |||:||||:||.::.|:|:||:|:.|..|....|..:::|||::.::|||.||:..||.::||.:
 Frog   189 FAGVYFEKVLKSSDTSLWVRNIQMYLSGILVTALCVYISDGSQVIEKGFFYGYNFLVWIVILLAS 253

  Fly   283 GGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYG 342
            .|||..:|||||.|||:|||:.:.||::|.:||:.:|...:||.|:.||..|..||:.||
 Frog   254 FGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVILFGLQITLTFAIGALFVCVSIYTYG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 130/318 (41%)
EamA 101..341 CDD:304911 107/239 (45%)
slc35a1XP_012818384.1 Nuc_sug_transp 7..313 CDD:282054 130/318 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D540031at33208
OrthoFinder 1 1.000 - - FOG0000573
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.