DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and slc35b1

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001004583.1 Gene:slc35b1 / 447844 ZFINID:ZDB-GENE-040912-148 Length:329 Species:Danio rerio


Alignment Length:339 Identity:69/339 - (20%)
Similarity:118/339 - (34%) Gaps:90/339 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RYARTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPS 106
            |||.|.   :|:.  .::.|.||:|:...|     || ..|...||.          ...:|  |
Zfish    56 RYATTL---VFIQ--CIINAAFARLLIQFF-----EG-SKQDHTRSW----------LYGLC--S 97

  Fly   107 LVYI---VQNNLLYVSASHLDAATYQVTYQLKIL-------TTAMFAVVILRRKLLNTQWGALLL 161
            |.|:   |.:|          :|...|.|..::|       ...:..|.|||:|....::..:.|
Zfish    98 LSYLGAMVSSN----------SALQYVNYPTQVLGKSCKPIPVMILGVTILRKKYPMAKYLCVFL 152

  Fly   162 LVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFE-- 224
            :|.|:.|......:|                 |..:.|.....|....|.:..|.|..|:..:  
Zfish   153 IVGGVALFLYKPNKG-----------------SSTSDEHVFGFGEMLLLLSLTLDGLTGVVQDHM 200

  Fly   225 --KILKGA-----EISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLL-- 280
              :...||     .:::|...| |.:..:..|.:..|:         .|...|...::.::|.  
Zfish   201 RGRFQTGANHMMLNVNMWSTLV-LGIAVLWSGEVWEFL---------AFTDRYPSIIYNILLFGI 255

  Fly   281 -QAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFL---Y 341
             .|.|...:.:.|.|...:.....|:.....:.:.|:.:|...::....||..||...:.|   :
Zfish   256 TSALGQTFIFMTVVYFGPLTCSIVTTTRKFFTILGSVLLFGNVISHMQWFGTILVFLGLGLDAKF 320

  Fly   342 GYDPARSAPKPTMH 355
            |     .:||.|.|
Zfish   321 G-----KSPKKTTH 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 64/324 (20%)
EamA 101..341 CDD:304911 49/264 (19%)
slc35b1NP_001004583.1 UAA 19..316 CDD:285625 63/319 (20%)
EamA <212..316 CDD:304911 19/113 (17%)
Di-lysine motif 325..329 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.