DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and rtet

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_524429.1 Gene:rtet / 42500 FlyBaseID:FBgn0028468 Length:477 Species:Drosophila melanogaster


Alignment Length:286 Identity:52/286 - (18%)
Similarity:89/286 - (31%) Gaps:114/286 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 FAVVILRRKLLNTQWGALLLLV-------------MGIVLVQLAQTEGPTSGSAGGAAAAATAAS 193
            ||:.:|.|.:.....|.:.|.:             .|:.||.:|.:.|...|...||..|..:..
  Fly   164 FALFVLARFVGGISKGNISLCMSVITDVSSVKTRGRGMALVGVAFSLGFIVGPMIGALFAIFSDK 228

  Fly   194 SGGA----------------------------PEQNRMLGLWAALG-ACFLSGFAGIYFEKILKG 229
            ||..                            |::.|:..:.:||. ...|..|:.|:....:|.
  Fly   229 SGSTWFVLPSLLAFGLAVGDLVVLACCLRETLPKEKRVKEISSALSYGLQLLNFSAIFRFAAIKN 293

  Fly   230 A---EISVWMRNVQL-----------------SLLSIPFG---------------LLTCFVNDGS 259
            .   :|:. :|::.|                 .|:...||               ::|.......
  Fly   294 VPKKDIAA-LRSIGLVYFLYLFLYSGLEFTVTFLMYHKFGYTSMDQAKMFLTTGVIMTLLQGSVV 357

  Fly   260 RIFDQGFFKGYDLFVWYLV--------------LLQAGGGL-----------IVAVVVKYADNIL 299
            |...:...|||.:|..||:              :|.||..|           :..:|.||.::..
  Fly   358 RRLPEAKIKGYAIFSLYLIVPAFVVVGLAEGSRMLYAGMTLFAISTAFAVTCLTTLVSKYGNDDQ 422

  Fly   300 KG-----------FATSLAIIISCVA 314
            ||           .|.:|..::.|:|
  Fly   423 KGSVLGIFRSLGALARALGPVVGCIA 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 52/286 (18%)
EamA 101..341 CDD:304911 52/286 (18%)
rtetNP_524429.1 MFS 105..466 CDD:119392 52/286 (18%)
MFS_1 108..442 CDD:284993 50/278 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.