DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and CG5281

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_650076.1 Gene:CG5281 / 41375 FlyBaseID:FBgn0037902 Length:347 Species:Drosophila melanogaster


Alignment Length:237 Identity:53/237 - (22%)
Similarity:89/237 - (37%) Gaps:66/237 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLPAPVTYSYSHRTVNANTLKYISLLTLTLQNAILGLSMRYARTRP---GDIFLSSTAVLMAEFA 64
            ||||.....|:.:.|.....:.|.||...:....|.||....|..|   ..:.:.||.|.:|.||
  Fly    77 LLPALPILIYTRQPVFPEGKRVILLLRCFMGTTGLMLSFYAFRHMPLADASVIIFSTPVFVAIFA 141

  Fly    65 KLITCLFL-----VFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLD 124
            :    .||     :||         |.:::.|::.    .:.:..|..|:       ..:|...|
  Fly   142 R----AFLKEPCTLFN---------VLTINMTLLG----VVLITRPPFVF-------GDTAESED 182

  Fly   125 AA--TYQVTYQLKILTTAMFA--VVILRRKLLN-------TQWGALLLLVMGIVLVQLAQTEGPT 178
            .|  ||.:...:..:::.:|.  |.||.|.|.|       |.:|.:.|:...||...:.....|:
  Fly   183 VAGKTYDIWGPVAAISSTLFGANVYILLRALKNLHFSVIMTNFGTIALVYTLIVCASIGAVCWPS 247

  Fly   179 SGSAGGAAAAATAASSGGAPEQNR----MLGLWAALGACFLS 216
            .|                   ::|    :||:::.||...|:
  Fly   248 CG-------------------RDRWLVVVLGVFSFLGQILLT 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 47/222 (21%)
EamA 101..341 CDD:304911 27/131 (21%)
CG5281NP_650076.1 RhaT 38..328 CDD:223769 53/237 (22%)
EamA 38..169 CDD:279264 26/108 (24%)
EamA 189..324 CDD:304911 20/101 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.