DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and slc35b2

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_991198.1 Gene:slc35b2 / 402931 ZFINID:ZDB-GENE-050213-1 Length:435 Species:Danio rerio


Alignment Length:281 Identity:60/281 - (21%)
Similarity:108/281 - (38%) Gaps:59/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALL 160
            ||  .|....||..|:.:...|.:...:...|..:....|::...:...::.|:.....::...:
Zfish   187 PM--YKYSFASLSNILSSWCQYEALKFISFPTQVLAKASKVIPVMLMGKIVSRKSYEYWEYLTAV 249

  Fly   161 LLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEK 225
            |:.:|:.:..|       |.|.....:..|..|                 |...|:|:  |.|:.
Zfish   250 LISLGVSMFLL-------SSSTDKHPSTVTTFS-----------------GVLILAGY--IVFDS 288

  Fly   226 ILKGAEISVWMRNV---QLSLLSIPFG--LLTCFVNDGSRIFDQG-------FFKGYDLFVWYLV 278
            .     .|.|..|:   ::|.:.:.||  |.:|....|| :.:||       |...:..|.::.|
Zfish   289 F-----TSNWQDNLFKYKMSSVQMMFGVNLFSCLFTVGS-LLEQGAFFNSLAFMTRHSEFAFHAV 347

  Fly   279 LL---QAGGGLIVAVVVKY----ADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIA 336
            ||   .|.|.|.:...:..    ...|:.....:|||::||    :::...::|....|.|:|..
Zfish   348 LLSVCSAFGQLFIFFTIAQFGAAVFTIIMTLRQALAILLSC----FLYGHPVSLTGGLGVGVVFL 408

  Fly   337 SIFLYGYDPARSAPKPTMHGP 357
            ::||..|  |||..|.:...|
Zfish   409 ALFLRIY--ARSRVKKSTKRP 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 54/264 (20%)
EamA 101..341 CDD:304911 51/258 (20%)
slc35b2NP_991198.1 UAA 115..417 CDD:285625 55/269 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.