DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Papst2

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_648954.1 Gene:Papst2 / 39914 FlyBaseID:FBgn0036695 Length:396 Species:Drosophila melanogaster


Alignment Length:265 Identity:55/265 - (20%)
Similarity:94/265 - (35%) Gaps:59/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 CVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIV 167
            |:|...|::   |..::...:..:...:.| |...|..:|...            .|:.:::|.:
  Fly   133 CIPMRTYLI---LAALTLGTMGLSNSSLGY-LNYPTQVIFKCC------------KLIPVLVGSI 181

  Fly   168 LVQLAQTEGPTSGSAGGAAAAA--------TAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFE 224
            |:|     |...|....|||..        |.|.|...|..| :||:....||.......|...|
  Fly   182 LIQ-----GKRYGLLDFAAATCMCIGLAWFTLADSQMTPNFN-LLGVAMISGALLCDAAIGNVQE 240

  Fly   225 KILK-----GAEI--------SVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGF---FKGYDLF 273
            |.::     .:|:        .|::..:.|...:...|...| :......|..||   ..||...
  Fly   241 KAMREFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFC-LEHPVETFGYGFLFSLSGYLGI 304

  Fly   274 VWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASI 338
            .:.|.|:::.|..|.|.|            |:....::...|..:|....|||:.:...:|:..|
  Fly   305 QFVLALVRSSGAPIAATV------------TTARKAVTIAFSFVLFSKPFTLQYLWSGLIVVLGI 357

  Fly   339 FLYGY 343
            :|..|
  Fly   358 YLNVY 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 54/262 (21%)
EamA 101..341 CDD:304911 53/261 (20%)
Papst2NP_648954.1 UAA 61..364 CDD:285625 55/265 (21%)
EamA 219..362 CDD:279264 32/155 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.