DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and CG14971

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_647817.2 Gene:CG14971 / 38429 FlyBaseID:FBgn0035449 Length:469 Species:Drosophila melanogaster


Alignment Length:179 Identity:38/179 - (21%)
Similarity:72/179 - (40%) Gaps:34/179 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ISLLTLTLQNAIL---------GLSMR--YARTRPGDIFLSSTAVLMAEFA----KLITCLFLVF 74
            |||.|:|..:.|:         ||..:  |..:..|   |..|.:||..:.    ..:...|::|
  Fly   179 ISLYTMTKSSTIVFILLFAIAFGLEKKSWYLVSIVG---LIGTGLLMFTYKSTDFNALGFFFILF 240

  Fly    75 NEEGKDAQ----KFVRSLHKTIIANPMD--------TLKVCVPSLVYIVQNNLLYVSASHLDAAT 127
            .......:    :|:....|..:.||:|        .:...||.::.|....|:.|.....:..:
  Fly   241 ASLSSGLRWSFAQFIMQKSKLGLHNPIDMIYYMQPWMIASLVPLVIGIEGAGLIAVIEDLHNHTS 305

  Fly   128 YQVTYQL-KILTTAMFAVVI-LRRKLLNTQWGALLLLVMGIV--LVQLA 172
            .::|:.: :|...|:.|.:: ....|:..:..:|.|.:.||.  :.|||
  Fly   306 NEITWAIARISAGALLAFLMEFSEFLVLCKTSSLTLSIAGIFKDICQLA 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 38/179 (21%)
EamA 101..341 CDD:304911 17/76 (22%)
CG14971NP_647817.2 TPT 86..382 CDD:281186 38/179 (21%)
PMT_2 111..325 CDD:304453 30/148 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.