DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and CG11537

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001097489.1 Gene:CG11537 / 38373 FlyBaseID:FBgn0035400 Length:705 Species:Drosophila melanogaster


Alignment Length:317 Identity:58/317 - (18%)
Similarity:118/317 - (37%) Gaps:68/317 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVT 131
            :..:||.|...|......:.:|::|.   |..|.  .:..||..::..|.::||..:.|.:....
  Fly   257 LVVIFLEFFAWGLLTMPIISTLNQTF---PDHTF--LMNGLVMGIKGILSFLSAPLIGALSDIWG 316

  Fly   132 YQLKILTTAMFAVVILRRKLLNTQWGALLLLVMG-------IVLVQLAQTEGPTSGSAGGAAAAA 189
            .:..:|.|..|..:.:....:||.|...::.:.|       :|...:|....|...|.....|:|
  Fly   317 RKFFLLVTVFFTCLPIPLMSINTWWFFAMISISGAFAVTFSVVFAYVADVTTPEERSKAYGLASA 381

  Fly   190 TAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCF 254
            |.|:|         |.:..|||...:.    :|.:.::.....::.:.:|...|:::|..|    
  Fly   382 TFAAS---------LVISPALGNALME----MYGDTLVVALSTAIALLDVFFILVAVPESL---- 429

  Fly   255 VNDGSRIFDQGFFKGYDLFVWYLVLLQAGGG-----LIVAVVVKYAD------------NILKGF 302
             ::..|....|....::....:|.|.:.|..     |.:.|::.|..            .:..||
  Fly   430 -SEKMRPASWGAPISWEQADPFLALRKVGTDKTVLMLCLTVLLSYLPEAGEYSCMFVYLKLKMGF 493

  Fly   303 -ATSLAIIISCVASIYIFDFNLTLQFSFGA---------------GLVIASIFLYGY 343
             ...:::.|:.|..:     ::|:|.:.|:               .|.|..:..||:
  Fly   494 NYVEVSVFIAIVGIL-----SITVQVTLGSFMQVFGAKRTIIMGLALEIVQLLWYGF 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 56/314 (18%)
EamA 101..341 CDD:304911 48/279 (17%)
CG11537NP_001097489.1 MFS 256..612 CDD:119392 58/317 (18%)
MFS_1 257..601 CDD:284993 58/317 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.