DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and slc35a5

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_005167880.1 Gene:slc35a5 / 368418 ZFINID:ZDB-GENE-030616-55 Length:463 Species:Danio rerio


Alignment Length:328 Identity:88/328 - (26%)
Similarity:145/328 - (44%) Gaps:44/328 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 FLSSTAVLMAEFAKLITCLFL---VFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQN 113
            :|.::..||||..||:.||.:   |...||:.    .:.|..:..|:.:..||..||:.:|.:.|
Zfish    90 YLPASVNLMAEAIKLVFCLVMSVRVIIREGRS----FKDLGCSSGASFLSYLKWSVPAFLYFLDN 150

  Fly   114 NLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPT 178
            .:::...::|..|...:...:.|.|||....|:|:|:|...||.:|::|.:.|  |.|....|..
Zfish   151 LIIFYVIAYLQPAMAVLFSNIVIFTTAFLFRVVLKRRLSWVQWASLIILFLSI--VSLTTGNGDQ 213

  Fly   179 SGSA-GGAAAAATAASSGGAPEQNRM-----------------------------LGLWAALGAC 213
            ...| .|...|..:..|....:...:                             ||....|..|
Zfish   214 HAMAVHGLHPAHISTPSNSCLKYTHLHQVHQSHNESYWSRELWDSQLIHKLNSFGLGYVLLLLQC 278

  Fly   214 FLSGFAGIYFEKILKGAE---ISVWMRNVQLSLLSIPFGLLTCFVNDGSR--IFDQGFFKGYDLF 273
            |:|..|.||.|||||..|   .|::::|.:|.|..:.|..||..::...|  ....|...|:::|
Zfish   279 FISALANIYNEKILKEGEQLVESIFIQNSKLYLFGLVFNSLTLLLHADYRNLTLHCGILYGHNVF 343

  Fly   274 VWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASI 338
            ...|..:.|..||.||.::|:.||:.......:..::....|.::|||..::.|...|.:|:.||
Zfish   344 SVALGFVTAALGLSVAFILKFRDNMFHVLTGQITTVVVTALSFFLFDFQPSMDFFMQAPVVLLSI 408

  Fly   339 FLY 341
            |:|
Zfish   409 FIY 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 88/328 (27%)
EamA 101..341 CDD:304911 72/274 (26%)
slc35a5XP_005167880.1 Nuc_sug_transp 72..411 CDD:282054 87/326 (27%)
EamA 138..411 CDD:304911 72/274 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D703674at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.