DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and CG8195

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster


Alignment Length:313 Identity:66/313 - (21%)
Similarity:99/313 - (31%) Gaps:113/313 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPAPVTYSYS---------HRTVNANTL--------KYISLLTLTLQNAILGLSMRYARTRPGDI 51
            |.|.::|:.|         |:|.....|        .|...|.|.:..|.:            ..
  Fly   154 LMARLSYAASLRIRRQKTHHKTAKTALLFCLLWFAANYFFQLALEMDEAAM------------IT 206

  Fly    52 FLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLL 116
            .:|||:      :..|.||..||.....|.....:     :||..|:     :..:|.|..|:| 
  Fly   207 LVSSTS------SFFIICLAAVFPSATGDKLTITK-----VIAVAMN-----IGGVVAITMNDL- 254

  Fly   117 YVSASHLDAATYQVTYQLKILTTAMF--AVVILRRKLLNTQ--------------WGALLLLVMG 165
                 |....|..|   |..|.:|.|  |.::..::..:|:              |..|||..:.
  Fly   255 -----HDTKMTRGV---LLALFSAFFYAAYLVFVKRKSDTEEKVDIPLFFGFVGLWNMLLLWPIF 311

  Fly   166 IVL--VQLAQTEGPTSGS-----AGGAAAAATAASSGGAPEQNRMLGLWAALGACFL-SGFAG-- 220
            .:|  .::...|.|:.|.     ..|......:.:            ||  |..||| |...|  
  Fly   312 FILHFTKIETFELPSQGQFALLFLNGLVGTVLSEA------------LW--LWGCFLTSSLIGTL 362

  Fly   221 ---------IYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFV-----NDGS 259
                     |.|:.:||....|     ....:.|||..:...||     ||.|
  Fly   363 AMSLQIPLAILFDVLLKNKPYS-----PMFYMGSIPIFVALVFVSLLMRNDDS 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 60/290 (21%)
EamA 101..341 CDD:304911 43/199 (22%)
CG8195NP_611049.1 2A78 153..399 CDD:273359 61/300 (20%)
EamA 260..403 CDD:279264 35/164 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.