DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and SLC35B2

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_835361.1 Gene:SLC35B2 / 347734 HGNCID:16872 Length:432 Species:Homo sapiens


Alignment Length:345 Identity:67/345 - (19%)
Similarity:126/345 - (36%) Gaps:73/345 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ISLLTL-TLQNAILGLSMRYARTRPGDIFLSST-AVLMAEFAKLI----TCLFLVFNEEGKDAQK 83
            :|.||. .||..::..|.....|.||:.|..|. .|||.....||    :|:.......|.    
Human   121 VSYLTWGVLQERVMTRSYGATATSPGERFTDSQFLVLMNRVLALIVAGLSCVLCKQPRHGA---- 181

  Fly    84 FVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILR 148
                        ||  .:....||..::.:...|.:...:...|..:....|::...:...::.|
Human   182 ------------PM--YRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMLMGKLVSR 232

  Fly   149 RKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGAC 213
            |...:.::....|:.:|:.:..|:....|.|       :.||..|                 |..
Human   233 RSYEHWEYLTATLISIGVSMFLLSSGPEPRS-------SPATTLS-----------------GLI 273

  Fly   214 FLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGL--LTCFVNDGSRIFDQG-------FFKG 269
            .|:|:  |.|:......:.:::.  .::|.:.:.||:  .:|....|| :.:||       |...
Human   274 LLAGY--IAFDSFTSNWQDALFA--YKMSSVQMMFGVNFFSCLFTVGS-LLEQGALLEGTRFMGR 333

  Fly   270 YDLFVWYLVLL---QAGGGLIVAVVV----KYADNILKGFATSLAIIISCVASIYIFDFNLTLQF 327
            :..|..:.:||   .|.|.|.:...:    .....|:.....:.||::||:    ::...:|:..
Human   334 HSEFAAHALLLSICSACGQLFIFYTIGQFGAAVFTIIMTLRQAFAILLSCL----LYGHTVTVVG 394

  Fly   328 SFGAGLVIASIFLYGYDPAR 347
            ..|..:|.|::.|..|...|
Human   395 GLGVAVVFAALLLRVYARGR 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 65/338 (19%)
EamA 101..341 CDD:304911 44/255 (17%)
SLC35B2NP_835361.1 UAA 111..412 CDD:312076 66/341 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.